General Information

  • ID:  hor001505
  • Uniprot ID:  O61466
  • Protein name:  GAKFIRF-amide
  • Gene name:  flp-5
  • Organism:  Caenorhabditis elegans
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  Expressed from the comma stage of embryogenesis, during all larval stages, and in adults. |Each flp gene is expressed in a distinct set of neurons. Flp-5 is expressed in the ASE sensory neurons, the 14 and M4 cholinergic pharyngeal motoneurons, and the PV
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GAKFIRF
  • Length:  7(55-61)
  • Propeptide:  MSSRSTTIAFLFIATLLVFQCVSAQSSAEDADYLEKYQRIARAPKPKFIRFGRAGAKFIRFGRSRNTWEDGYASPSVNELYVKRGAKFIRFG
  • Signal peptide:  NA
  • Modification:  T7 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Has an excitatory effect on dissected pharyngeal myogenic muscle system.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O61466-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001505_AF2.pdbhor001505_ESM.pdb

Physical Information

Mass: 94522 Formula: C41H63N11O8
Absent amino acids: CDEHLMNPQSTVWY Common amino acids: F
pI: 11.65 Basic residues: 2
Polar residues: 1 Hydrophobic residues: 4
Hydrophobicity: 44.29 Boman Index: -684
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 70
Instability Index: -355.71 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  16061202
  • Title:  Discovering Neuropeptides in Caenorhabditis Elegans by Two Dimensional Liquid Chromatography and Mass Spectrometry